atrial fibrillationHFpEFheart failurenatriuretic peptide
…acteristics (elderly, hypertension, obesity, diabetes mellitus, atrial fibrillation), ECG, echocardiographic parameters and diagnostic laboratory t…
283articles mentioning diseases
380disease mentions
1distinct diseases extracted
0%of mentions human-reviewed
Active filtersEntity: Atrial fibrillation ×
Atrial fibrillation
This disease is selected. Its supporting articles are shown below.
Articles mentioning Atrial fibrillation
283 articles · page 16 of 24atrial fibrillationepilepsylevetiracetamwarfarin
…A 52-year-old was referred by his general practitioner with new atrial fibrillation. The patient reported 6 weeks of mild dyspnoea which was non-li…
atrial fibrillationUniversity of Florida Healthclinician educationbest practice alertAnticoagulationanticoagulant
… prevention is often recommended for patients with non-valvular atrial fibrillation (AF), yet many eligible patients do not receive guideline-conco…
atrial fibrillationHeartheartjnl-2025
…Commentary on: Mu et al Long-term cardiovascular risks after atrial fibrillation diagnosis: a systematic review and meta-analysis. Heart. 2025 S…
atrial fibrillationUK Biobankanticoagulation
…Background Despite anticoagulation, patients with atrial fibrillation (AF) experience persistent elevated cardiovascular risk, with c…
Atrial fibrillationcardiac rehabilitationNCT06772207
…Introduction Atrial fibrillation (AF) is a growing public health concern associated with signifi…
cardioembolic strokeAtrial fibrillationAFRSischaemic strokeRadboud University Medical CentreHospital del Mar Barcelona
…Introduction Atrial fibrillation (AF) is the leading cause of cardioembolic stroke and is associated with increased stroke severity and fatality. …
atrial fibrillationanticoagulant therapy
…The prevalence of atrial fibrillation (AF) increases with advancing age. AF is associated with thromb…
structural heart diseaseAtrial fibrillation
…rhythmia most prevalent in older age groups and with underlying structural heart disease. However, it can occasionally present in younger, otherwise hea…
hiccupsatrial fibrillationphrenic nerve blockoesophageal dilation
…erve decompression.Conclusions Invasive procedures can palliate hiccups with an acceptable safety profile. However, these procedures ap…
atrial fibrillationischaemic strokeAFcalcium channel blockersthiazide diureticsloop diureticspotassium-sparing agentssecondary stroke prevention
… up until December 2021 and stratified based on the presence of atrial fibrillation (AF).Outcome measures Risk of stroke recurrence was assessed us…
atrial fibrillationDOACVanderstuyft et aldirect oral anticoagulant
… antithrombotic prescribing quality in very old inpatients with atrial fibrillation (AF) on geriatric wards in Belgium. In a cohort with a mean age…